Mass Spectrometry Specialist - University of Copenhagen FOOD Dept
Department of Food Science (FOOD) at Faculty of Science, the University of Copenhagen, is looking for a highly motivated and technically skilled staff scientist for the execution of mass spectrometry analyses starting from 1 November 2025 or as soon as possible hereafter. The position is limited until 31 December 2027. The position will be associated with the Food Proteins research group (led by Professor Marianne Nissen Lund) and the Novo Nordisk funded challenge project SEEDFOOD: Functional and palatable plant seed storage proteins for sustainable foods.
About us
The Food proteins group aims to develop an in-depth mechanistic understanding of complex interactions of food components, which will make it possible to predict, control, and modulate the chemical reactions taking place in food and beverages during production and storage. We have special emphasis on protein quality and protein modifications induced by the Maillard reaction (i.e. protein glycation), oxidation, and reactions with polyphenols, and how these reactions affect flavour, protein structure and functionality, nutritional value and health. In the context of the announced position, we aim to strengthen our expertise in chromatography and mass spectrometry to study protein chemistry in a food science context.
The successful candidate will work in a highly cross-disciplinary team that includes expertise in the areas of food chemistry, protein (bio)chemistry, and advanced multivariate data analysis (approximately 20 people).
Tasks
Your tasks will include:
- Run state-of-the-art LC-MS and HPLC platform for measurements of food samples.
- Design and conduct experiments with the LC-MS platform and analyze the acquired data.
- Support of group members, contributing to creating a collaborative and inclusive research environment.
- Software control for data acquisition and analysis.
- Coordinate with academic and industrial research partners.
- Help with teaching and supervision of students.
We expect
- You have a PhD in mass spectrometry, experimental protein chemistry and related fields.
- You have substantial work experience in development of quantitative HPLC and LC-MS methods for peptides, proteins and small molecules.
- You have substantial experience in analysis of HPLC and LC-MS data using software such as Chromeleon, Skyline, Proteome Discoverer, and MaxQuant.
- You have experience with analysis of protein modifications, protein crosslinking and disulfide bonds using LC-MS.
- You have creative thinking for troubleshooting.
- You are interested in working in a multidisciplinary and multicultural team.
- Experience with analysis of food proteins and handling of food samples is advantageous.
- Good English skills, written and spoken.
We offer:
- The possibility to engage in high-impact, multidisciplinary research.
- A stimulating, diverse and international research environment and international collaborations.
- Access to state-of-the-art equipment, facilities, and infrastructure.
- A supportive scientific and social network, including mentoring and career development.
Terms of salary and employment
The employment and salary is made in accordance with the Circular on the Collective Agreement concerning academics in the state sector concluded between the Ministry of Finance and AC (the Danish Confederation of Professional Associations).
Employment will be as academic employee or Special Consultant depending on qualifications. Negotiation for salary supplement is possible. The working time are 37 hours per week on average. The working hours are flexible.
UCPH is in the process of designing a new shared administrative organisation at UCPH, which is expected to lead to changes within the next 12 - 18 months. The purpose of the administrative reform is, among other things, to strengthen cross-organisational cooperation, increase efficiency, and ensure good career paths for administrative staff members at UCPH. The reform will lead to cutbacks on administration. You are encouraged to contact Marianne Nissen Lund (mnlfrancespayneericvalenciapatrickcampbell@lloyd.dkfood.ku.dkallen-warner.dk) to learn more about the connection between this position and the administrative reform.
Your application
If you find the job description interesting, please send an electronic application with attachment via Jobportalen (click on the link "Apply Now" at the bottom of the post) no later than 14 September 2025.
The application must include the following:
- Letter of application/motivation (max 1 page)
- Curriculum Vitae
- Copy of relevant certificates/diplomas.
Interviews will take place week 39-40.
The University of Copenhagen seeks to reflect society and encourages applications irrespective of personal background.
Further questions
Any questions about the position may be directed to Project coordinator John Greany Sørensen (kingshellyjohnsycollinsslane@murphy.dkwalsh.dkfood.ku.dkedwards-thompson.dk ).
The Faculty of Science at the University of Copenhagen – or SCIENCE – is Denmark's largest science research and education institution with 4,000 employees and 9,700 Bachelor and Master's students in 12 departments. The Faculty has an annual budget of DKK 3 billion.
Learn more about The Faculty of Science at www.science.ku.dk